Transcript | Ll_transcript_150713 |
---|---|
CDS coordinates | 3-527 (+) |
Peptide sequence | HNHHCTEHPAYHLFHCVESPKVFSSLYSMAQTTPNHTQTVSGWAALDSGGKIVPYTFKRRENGVNDVTIKILYCGICHTDIHHAKDDWGITMYPVVPGHEITGVITKVGSDVKGFKEGDRVGVGCLAATCLECDLCKNDEENYCDKLALTYNGIFWDGSITYGGYSKMLVADHR* |
ORF Type | 5prime_partial |
Blastp | Probable cinnamyl alcohol dehydrogenase 6 from Oryza sativa with 77.08% of identity |
---|---|
Blastx | Probable cinnamyl alcohol dehydrogenase 6 from Oryza sativa with 75.51% of identity |
Eggnog | alcohol dehydrogenase(COG1064) |
Kegg | Link to kegg annotations (4335223) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449482.1) |
Pfam | Alcohol dehydrogenase GroES-like domain (PF08240.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer