Protein coding transcript 236485

• Transcript: Ll_transcript_150728
• CDS coordinates: 3-527 (+)
• Peptide sequence: HNHHCTEHPAYHLFHCVESPKVFSSLYSMAQTTPNHTQTVSGWAALDSGGKIVPYTFKRRENGVNDVTIKILYCGICHTDIHHAKDDWGITMYPVVPGHEITGVITKVGSDVKGFKEGDRVGVGCLAATCLECDLCKNDEENYCDKLALTYNGIFWDGSITYGGYSKMLVADHR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_150728

• Blastp: Probable cinnamyl alcohol dehydrogenase 6 from Oryza sativa with 77.08% of identity
• Blastx: Probable cinnamyl alcohol dehydrogenase 6 from Oryza sativa with 75.51% of identity
• Eggnog: alcohol dehydrogenase(COG1064)
• Kegg: Link to kegg annotations (4335223)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449482.1)
• Pfam: Alcohol dehydrogenase GroES-like domain (PF08240.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;