Transcript | Ll_transcript_329264 |
---|---|
CDS coordinates | 45-488 (+) |
Peptide sequence | MAMTMAMVSPWISTTTTTTRSSLSLFTSSRPTLSTTSLSFTSPSPLLHSSFISSSSLSFPSSLSGLSLGLDLASNVGGRGGKRRGLVVRAGKAALCQTKRSRSRKSLARTHGFRRRMRTPGGRAILKRRRAKGRKILCTKTHSHSGK* |
ORF Type | complete |
Blastp | 50S ribosomal protein L34, chloroplastic from Arabidopsis with 69.31% of identity |
---|---|
Blastx | 50S ribosomal protein L34, chloroplastic from Spinacia with 83.93% of identity |
Eggnog | ribosomal protein l34(ENOG410Y1JV) |
Kegg | Link to kegg annotations (AT1G29070) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426230.1) |
Pfam | Ribosomal protein L34 (PF00468.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer