Protein coding transcript 236533

• Transcript: Ll_transcript_150559
• CDS coordinates: 69-407 (+)
• Peptide sequence: MDLLARFIADKPVVIFSKSTCCMSHTVKALICNFGANPTVFEVDKMANGYLIERALVLLGCHPSVPAVFIGQQFIRGADKVIGLNIQNKLSQLLLNAKAIFIWVSYSSIKDS*
• ORF Type: complete

Annotations of Ll_transcript_150559

• Blastp: Monothiol glutaredoxin-S1 from Arabidopsis with 55.88% of identity
• Blastx: Monothiol glutaredoxin-S1 from Arabidopsis with 57.14% of identity
• Eggnog: Glutaredoxin(COG0695)
• Kegg: Link to kegg annotations (AT1G03020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439137.1)
• Pfam: Glutaredoxin (PF00462.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;