Protein coding transcript 236543

• Transcript: Ll_transcript_149776
• CDS coordinates: 614-994 (+)
• Peptide sequence: MWDDGNSLGPKEVHNYLTQVMYNRRNKFNPLWNSLVLGGVKNGQKYLGTVNMIGINYEDNHVATGLGNHLARPILRDEWHENLTFEDAVKLLEKCMRVLLYRDRSAVNKIQVLFFFLFPISPCSLQ*
• ORF Type: complete

Annotations of Ll_transcript_149776

• Blastp: Proteasome subunit beta type-4 from Arabidopsis with 83.04% of identity
• Blastx: Proteasome subunit beta type-4 from Arabidopsis with 80.17% of identity
• Eggnog: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)(ENOG410YAMA)
• Kegg: Link to kegg annotations (AT1G56450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448711.1)
• Pfam: Proteasome subunit (PF00227.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;