Protein coding transcript 236691

• Transcript: Ll_transcript_150365
• CDS coordinates: 3-365 (+)
• Peptide sequence: ICYLKSYVFWFVLCCFKFGFVLDLQSKAKEMVMLAEKMRTQLLSGSSSQANTTGDEQMGSKEEMQELLLSVGIISPVTKESAGALYHQQLSRQLADFVKVPLERAGGIINLIDIYCLFNRA
• ORF Type: internal

Annotations of Ll_transcript_150365

• Blastp: Vacuolar protein sorting-associated protein 36 from Arabidopsis with 75.51% of identity
• Blastx: Vacuolar protein sorting-associated protein 36 from Arabidopsis with 75.51% of identity
• Eggnog: vacuolar protein sorting(ENOG410XR74)
• Kegg: Link to kegg annotations (AT5G04920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449356.1)
• Pfam: EAP30/Vps36 family (PF04157.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;