Transcript | Ll_transcript_215069 |
---|---|
CDS coordinates | 122-1561 (+) |
Peptide sequence | MAKSISLTNHLSRLISYSSSSSSTITTLTFLSRSQFHFPFRSFSFRPLSTNTTPYPLQYDLIINRPPPQTPRPPPVRSNSSHDNAVSEPDEPDLRLDTWVDRKLAQPGSQLEKGKRKYYNKRRKRMYGGSDSDEDGNRRMEDEMIELKPEVIEFPTLHKREEELHFYDAFSYPWEKDKHYKMVYQLEKKYFPDQCLDKAFLQPGAKQERSNVNDNEIKAKKKEEDKKLVFFEGEKEKSDKDVSEKKVEDFFKGLKKKKINSDPVVGDGNVNGVGEPFFSSRRTGLPPVWDSPHGTVLLINKPKGWTSFTVCGKLRRLVKVKKVGHAGTLDPMATGLLIVCVGKATKLVDRYQGMIKGYSGVFRLGEATSTWDADSPVIQREPWEHIKDEDIKKNASSFCGEIWQVPPMFSAIKVGGEKMYEKARRGESIELSPRRISIFQFDIERSLDDRQNLIFRVTCSKGTYIRSLCADFGKALGRY* |
ORF Type | complete |
Blastp | tRNA pseudouridine synthase B from Flavobacterium with 48.95% of identity |
---|---|
Blastx | tRNA pseudouridine synthase B from Flavobacterium with 48.42% of identity |
Eggnog | Responsible for synthesis of pseudouridine from uracil- 55 in the psi GC loop of transfer RNAs (By similarity)(COG0130) |
Kegg | Link to kegg annotations (Fjoh_0570) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428203.1) |
Pfam | TruB family pseudouridylate synthase (N terminal domain) (PF01509.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer