Protein coding transcript 237095

• Transcript: Ll_transcript_216093
• CDS coordinates: 1-372 (+)
• Peptide sequence: VESSDTIANVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESPLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
• ORF Type: internal

Annotations of Ll_transcript_216093

• Blastp: Polyubiquitin from Hordeum with 98.39% of identity
• Blastx: Polyubiquitin from Hordeum with 98.39% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000474)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004497490.1)
• Pfam: Ubiquitin family (PF00240.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;