Transcript | Ll_transcript_216093 |
---|---|
CDS coordinates | 1-372 (+) |
Peptide sequence | VESSDTIANVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESPLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE |
ORF Type | internal |
Blastp | Polyubiquitin from Hordeum with 98.39% of identity |
---|---|
Blastx | Polyubiquitin from Hordeum with 98.39% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0000474) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004497490.1) |
Pfam | Ubiquitin family (PF00240.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer