Protein coding transcript 237214

• Transcript: Ll_transcript_213518
• CDS coordinates: 2-1162 (+)
• Peptide sequence: IYFIKHCVSKGATMWSIVTDPIKSLVSKVVNQSIHRDFHDVVARMTIIDAFLFFIIHSIDKLGIWHRLPVFLGLLYLAIRRHLHQEYNLFNVGSTPLGVRFNPSDFPFRTAEGKFNDPFNEVAGSQGSFFGRNVLPVDQKQKLLKPNPMVVATKLLARRTYKDTGKQFNVIAASWIQFMIHDWIDHLEETSQIEVTAPREVASECPLKSFKFYKTKETPTGFYDIKTGSTNIRTPWWDGSAIYGSNGEVLNKVRTFKDGKLKISKEGHLLHNENGTAISGDIRNSWAGVSTLQALFVQEHNAICDTLKKDYRELEDEDLYRHARLVTAAVIAKVHTIDWTVELLKTDTLLAGMRANWYKTLLYVYLLLLLLLLLFIFFLVELFYIYV
• ORF Type: internal

Annotations of Ll_transcript_213518

• Blastp: Alpha-dioxygenase 1 from Arabidopsis with 71.26% of identity
• Blastx: Alpha-dioxygenase 1 from Arabidopsis with 71.6% of identity
• Eggnog: prostaglandin G H synthase and cyclooxygenase(ENOG410XPZ3)
• Kegg: Link to kegg annotations (AT3G01420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442589.1)
• Pfam: Animal haem peroxidase (PF03098.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;