Protein coding transcript 237236

• Transcript: Ll_transcript_216185
• CDS coordinates: 261-737 (+)
• Peptide sequence: MKIRIGPNTRSTTIFRRSVVNRKGSFVTSFITLGALWKLIEREMASLLQSLIDPKKNWLAALHMKTISRRLRNYGLRYDDLYDPYYDIDVQEALNRLPKEVVEARHQRLKRAIDLSMKHQYLPQDLQALQTPFRSYLQEMLAYVSAYLFLSQNFASSN*
• ORF Type: complete

Annotations of Ll_transcript_216185

• Blastp: Cytochrome b-c1 complex subunit 7-1 from Arabidopsis with 74.51% of identity
• Blastx: Cytochrome b-c1 complex subunit 7-1 from Arabidopsis with 75.25% of identity
• Eggnog: component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain (By similarity)(ENOG4111V1G)
• Kegg: Link to kegg annotations (AT4G32470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416722.1)
• Pfam: Ubiquinol-cytochrome C reductase complex 14kD subunit (PF02271.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;