Transcript | Ll_transcript_216185 |
---|---|
CDS coordinates | 261-737 (+) |
Peptide sequence | MKIRIGPNTRSTTIFRRSVVNRKGSFVTSFITLGALWKLIEREMASLLQSLIDPKKNWLAALHMKTISRRLRNYGLRYDDLYDPYYDIDVQEALNRLPKEVVEARHQRLKRAIDLSMKHQYLPQDLQALQTPFRSYLQEMLAYVSAYLFLSQNFASSN* |
ORF Type | complete |
Blastp | Cytochrome b-c1 complex subunit 7-1 from Arabidopsis with 74.51% of identity |
---|---|
Blastx | Cytochrome b-c1 complex subunit 7-1 from Arabidopsis with 75.25% of identity |
Eggnog | component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain (By similarity)(ENOG4111V1G) |
Kegg | Link to kegg annotations (AT4G32470) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416722.1) |
Pfam | Ubiquinol-cytochrome C reductase complex 14kD subunit (PF02271.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer