Protein coding transcript 237238

• Transcript: Ll_transcript_216189
• CDS coordinates: 104-475 (+)
• Peptide sequence: MKRNCTLDLCFHPSSCYSLSHNSMIEPMNINKNLHVILHNRHHKFDTTELQARMIIWLASQEMEQKKGGINSNPTPLISLQLHALLMHLPQGISIKKSIKSFLHKRKKRFQTHIDIATQSNTN*
• ORF Type: complete

Annotations of Ll_transcript_216189

• Blastp: Protein TIFY 5A from Arabidopsis with 36.89% of identity
• Blastx: Protein TIFY 5A from Arabidopsis with 36.89% of identity
• Eggnog: TIFY 5A-like(ENOG410Z61E)
• Kegg: Link to kegg annotations (AT1G30135)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436137.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;