Protein coding transcript 237242

• Transcript: Ll_transcript_216215
• CDS coordinates: 1067-1549 (+)
• Peptide sequence: MLMPKDPNATIIMLATGTGIAPFRSFLWKIFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKSPENFRLDFAVSREQTNEKGEKMYIQTRMAEYAEELWELLKKDNTFVYMCGLKGMEKGIDEIMAPLAAKEGIDWIEYKRQLKKAEQWNVEVY*
• ORF Type: complete

Annotations of Ll_transcript_216215

• Blastp: Ferredoxin--NADP reductase, leaf isozyme 2, chloroplastic from Arabidopsis with 86.25% of identity
• Blastx: Ferredoxin--NADP reductase, leaf isozyme 2, chloroplastic from Arabidopsis with 85.78% of identity
• Eggnog: Component of the sulfite reductase complex that catalyzes the 6-electron reduction of sulfite to sulfide. This is one of several activities required for the biosynthesis of L- cysteine from sulfate. The flavoprotein component catalyzes the electron flow from NADPH - FAD - FMN to the hemoprotein component (By similarity)(COG0369)
• Kegg: Link to kegg annotations (AT1G20020)
• CantataDB: Link to cantataDB annotations (CNT0000152)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424080.1)
• Pfam: Oxidoreductase NAD-binding domain (PF00175.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;