Transcript | Ll_transcript_216190 |
---|---|
CDS coordinates | 218-1312 (+) |
Peptide sequence | MSSVVTAAVSFSPSSTLPTRTSLSALERVPFQRVSFQYRDVSISGRGVSIRAQVTTDTEAAPITKVVKESKKQDEGVVVNRFKPKDPYTGRCLLNTKITGDDAPGETWHMVFTTEGEVPYREGQSIGVVPDGVDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNENGEVVKGVCSNFLCDLKPGNEVKITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKIFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKSPENFRLDFAVSREQTNEKGEKMYIQTRMAEYAEELWELLKKDNTFVYMCGLKGMEKGIDEIMAPLAAKEGIDWIEYKRQLKKAEQWNVEVY* |
ORF Type | complete |
Blastp | Ferredoxin--NADP reductase, chloroplastic from Vicia with 84.7% of identity |
---|---|
Blastx | Ferredoxin--NADP reductase, chloroplastic from Vicia with 84.7% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0000152) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424081.1) |
Pfam | Oxidoreductase NAD-binding domain (PF00175.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer