Protein coding transcript 237243

• Transcript: Ll_transcript_216190
• CDS coordinates: 218-1312 (+)
• Peptide sequence: MSSVVTAAVSFSPSSTLPTRTSLSALERVPFQRVSFQYRDVSISGRGVSIRAQVTTDTEAAPITKVVKESKKQDEGVVVNRFKPKDPYTGRCLLNTKITGDDAPGETWHMVFTTEGEVPYREGQSIGVVPDGVDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNENGEVVKGVCSNFLCDLKPGNEVKITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKIFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKSPENFRLDFAVSREQTNEKGEKMYIQTRMAEYAEELWELLKKDNTFVYMCGLKGMEKGIDEIMAPLAAKEGIDWIEYKRQLKKAEQWNVEVY*
• ORF Type: complete

Annotations of Ll_transcript_216190

• Blastp: Ferredoxin--NADP reductase, chloroplastic from Vicia with 84.7% of identity
• Blastx: Ferredoxin--NADP reductase, chloroplastic from Vicia with 84.7% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000152)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424081.1)
• Pfam: Oxidoreductase NAD-binding domain (PF00175.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;