Protein coding transcript 237244

• Transcript: Ll_transcript_216191
• CDS coordinates: 364-678 (+)
• Peptide sequence: MLMPKDPNATIIMLATGTGIAPFRSFLWKIFFEKHDDYKFNGLAWLFLGVPTSSSLLYKEEFEKMKEKSPENFRLDFAVSREQTNEKGEKMYIQTRMAEYAEELW
• ORF Type: 3prime_partial

Annotations of Ll_transcript_216191

• Blastp: Ferredoxin--NADP reductase, leaf isozyme 2, chloroplastic from Arabidopsis with 86.67% of identity
• Blastx: Ferredoxin--NADP reductase, leaf isozyme, chloroplastic from Oryza sativa with 69.91% of identity
• Eggnog: Component of the sulfite reductase complex that catalyzes the 6-electron reduction of sulfite to sulfide. This is one of several activities required for the biosynthesis of L- cysteine from sulfate. The flavoprotein component catalyzes the electron flow from NADPH - FAD - FMN to the hemoprotein component (By similarity)(COG0369)
• Kegg: Link to kegg annotations (AT1G20020)
• CantataDB: Link to cantataDB annotations (CNT0000152)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444844.1)
• Pfam: Oxidoreductase NAD-binding domain (PF00175.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;