Protein coding transcript 237249

• Transcript: Ll_transcript_216209
• CDS coordinates: 251-901 (+)
• Peptide sequence: MTSVVTAAVSFPSSSTVPSRTSFSALDRVPFQKVSFQYRDFSISGRGVSIKAQVTTEEPVTKVVKESKKQDEGVVVNKFKPKDPYTGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGVIADGIDKNGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNDNGEVVKGVCSNFLCDLKPGNEVKITGPVGKEMLMPKDPNATIIMVH*
• ORF Type: complete

Annotations of Ll_transcript_216209

• Blastp: Ferredoxin--NADP reductase, chloroplastic from Vicia with 79.45% of identity
• Blastx: Ferredoxin--NADP reductase, leaf-type isozyme, chloroplastic from Nicotiana with 80.95% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000152)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444844.1)
• Pfam: Oxidoreductase FAD-binding domain (PF00970.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;