Protein coding transcript 237260

• Transcript: Ll_transcript_216002
• CDS coordinates: 328-774 (+)
• Peptide sequence: MDFVFSLKPHSHSVFLKAPYSSSLSLPLNFHSLRPLSASKHARIHCEFERKINGALSDDSDPRFLDRQKALEAAMNDINNSFGKGSVTRLGSAGGALVETFPSGCLTLDCALGGGLPKGRIIEVLALCFYSFSSFSDHFCIHWVLDRV*
• ORF Type: complete

Annotations of Ll_transcript_216002

• Blastp: DNA repair protein recA homolog 1, chloroplastic from Arabidopsis with 68.57% of identity
• Blastx: DNA repair protein recA homolog 1, chloroplastic from Arabidopsis with 60% of identity
• Eggnog: Can catalyze the hydrolysis of ATP in the presence of single-stranded DNA, the ATP-dependent uptake of single-stranded DNA by duplex DNA, and the ATP-dependent hybridization of homologous single-stranded DNAs. It interacts with LexA causing its activation and leading to its autocatalytic cleavage (By similarity)(COG0468)
• Kegg: Link to kegg annotations (AT1G79050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446739.1)
• Pfam: recA bacterial DNA recombination protein (PF00154.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;