Transcript | Ll_transcript_215988 |
---|---|
CDS coordinates | 1449-2480 (+) |
Peptide sequence | MLHKNSTPFFCYGFNYHQKALEAAMNDINNSFGKGSVTRLGSAGGALVETFPSGCLTLDCALGGGLPKGRIIEIFGPESSGKTTLALHAIAEVQKLGGNAVLVDAEHAFDPAYSKALGVDVENLIVCQPDHGEMGLEIADRMCRSGAVDLICVDSVSALTPRAEIEGEIGMQQMGLQARLMSQALRKMSGNASKAGCTLIFLNQIRYKIGVFYGNPEVTSGGIALKFFASLRLEVRSIGKIKSAKGDEEIGLKVRVRVQKSKVSRPYKIAEFEIIFGEGVSKLGCILDCAEMMDVVLKKGSWYSYGDHRLGQGREKAIQYLKENTHLLEEIEKVVCSEPAKCY* |
ORF Type | complete |
Blastp | DNA repair protein recA homolog 1, chloroplastic from Arabidopsis with 88.2% of identity |
---|---|
Blastx | DNA repair protein recA homolog 1, chloroplastic from Arabidopsis with 88.2% of identity |
Eggnog | Can catalyze the hydrolysis of ATP in the presence of single-stranded DNA, the ATP-dependent uptake of single-stranded DNA by duplex DNA, and the ATP-dependent hybridization of homologous single-stranded DNAs. It interacts with LexA causing its activation and leading to its autocatalytic cleavage (By similarity)(COG0468) |
Kegg | Link to kegg annotations (AT1G79050) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446739.1) |
Pfam | recA bacterial DNA recombination protein (PF00154.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer