Transcript | Ll_transcript_214414 |
---|---|
CDS coordinates | 35-859 (+) |
Peptide sequence | MCSSMCYNYYTCCVLVEKQYHRHPKTIQVFPLVGHITYRMHYFYCTLYVVRSFDVSLLIIPASREKSYKQIEAAIAKFREIKDNINEGLKFYVTLQDAITNVKQQCSDFVMTRNIQCREMIEDVQRQVAGLSFQDNRNTSAFNGNYPSVGHQNQRPNAQQTDTRPQTPYYQPSEQPPVSGYGHAPNPYGPGPAHQPPPPYHIPQTSGASYPPPPQAHHPQASHDYGQPAYPGWRGPYYNGQAQHQQQQPASAPQPPYTAQSPYPPHQSGYYKQQ* |
ORF Type | complete |
Blastp | Vacuolar-sorting protein BRO1 from Arabidopsis with 48.42% of identity |
---|---|
Blastx | Vacuolar-sorting protein BRO1 from Arabidopsis with 62.99% of identity |
Eggnog | Rhophilin, Rho GTPase binding protein(ENOG410XQX6) |
Kegg | Link to kegg annotations (AT1G15130) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456175.1) |
Pfam | ALIX V-shaped domain binding to HIV (PF13949.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer