Protein coding transcript 237335

• Transcript: Ll_transcript_214412
• CDS coordinates: 1-300 (+)
• Peptide sequence: PIMSFDQNEDAIVGSLKHSLRQLETLGAERAGLEDMLKEMKRKDDILPKLMTFSGSHEDLFKKEISKYDHICEEIGQNIEAQEQLLVHIQVPLTLCAPI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_214412

• Blastp: Vacuolar-sorting protein BRO1 from Arabidopsis with 80.22% of identity
• Blastx: Vacuolar-sorting protein BRO1 from Arabidopsis with 80.22% of identity
• Eggnog: Rhophilin, Rho GTPase binding protein(ENOG410XQX6)
• Kegg: Link to kegg annotations (AT1G15130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020966778.1)
• Pfam: ALIX V-shaped domain binding to HIV (PF13949.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;