Protein coding transcript 237364

• Transcript: Ll_transcript_213984
• CDS coordinates: 1-705 (+)
• Peptide sequence: LHYLHTGASQSIIHRDVKTTNILLDDNFVAKVADFGLSKTGPALDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLMEVLCSRPALNPVLPRDQVNIAEWAMGWQKKGMLDQIMDQKLTGCVNSASLKKFGETAEKCLAEYGVDRPSMGDVLWNLEYALRLQETASLALTEPDNNSTNQITVIQLTTLQNFDNGLSMIGGGNSATDDDAEDATTSAVFAQLVNPCGR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_213984

• Blastp: Receptor-like protein kinase THESEUS 1 from Arabidopsis with 83.61% of identity
• Blastx: Receptor-like protein kinase THESEUS 1 from Arabidopsis with 82.77% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G54380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443980.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;