Protein coding transcript 237383

• Transcript: Ll_transcript_215049
• CDS coordinates: 155-508 (+)
• Peptide sequence: MNPMSWATTDDVLLSTSLATYLDKKLIVLLRDGRKLLGLLRSFDQFANVVLEGACERVIVGDLYCDVPLGLYVIRGENVVLIGELESDKEELPPHMACVSEAEIRKVSTSCCILYYC*
• ORF Type: complete

Annotations of Ll_transcript_215049

• Blastp: Sm-like protein LSM1B from Arabidopsis with 76.19% of identity
• Blastx: Sm-like protein LSM1B from Arabidopsis with 76.19% of identity
• Eggnog: LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae)(ENOG411224Q)
• Kegg: Link to kegg annotations (AT3G14080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415981.1)
• Pfam: LSM domain (PF01423.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;