Protein coding transcript 237401

• Transcript: Ll_transcript_215046
• CDS coordinates: 1226-1966 (+)
• Peptide sequence: MYVFVKLLFDYLLSRWAAIASYLPQRTDNDIKNYWNTHLKKKMKKLHVALDPHMASDSTTTGQYPSKSFNYNRSLDISRSNHGSPLRPIQSQTHSSTYASSTENISRLLEGWMRSSPKKPLKEITQEEEKFQANDEFENSNNLVKPALMPATLNLQLQQQKTKKDMVSHEEFDSILSFENLNTAPWDKSTCDSMPEKVYVTAVKGAEKNRLTCENSNAPPLSFLEKWLLDENVGHVEEMIQLSPMF*
• ORF Type: complete

Annotations of Ll_transcript_215046

• Blastp: Transcription factor MYB30 from Arabidopsis with 33.5% of identity
• Blastx: Myb-related protein 306 from Antirrhinum with 82.98% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT3G28910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434865.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;