Transcript | Ll_transcript_365955 |
---|---|
CDS coordinates | 1379-1711 (+) |
Peptide sequence | MADALEAGGFFPIRKSHDAAVGTLVHLLKKAPPLRQDLSTSEHLSQGAHSEIWNNNIKEPNQTPDAPMPVSMMSSGLIATRKTTADALEEFHSYREMKNLLLTGGRKNQI* |
ORF Type | complete |
Blastp | Autophagy-related protein 13b from Arabidopsis with 49.02% of identity |
---|---|
Blastx | Autophagy-related protein 13b from Arabidopsis with 48.7% of identity |
Eggnog | Activates the ATG1 kinase in a nutritional condition dependent manner through the TOR pathway, leading to autophagy. Also invoved in cytoplasm to vacuole transport (Cvt) and more specifically in Cvt vesicle formation. Seems to play a role in the switching machinery regulating the conversion between the Cvt pathway and autophagy. Finally, ATG13 is also required for glycogen storage during stationary phase (By similarity)(ENOG410Y4BP) |
Kegg | Link to kegg annotations (AT3G18770) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462868.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer