Protein coding transcript 237631

• Transcript: Ll_transcript_214499
• CDS coordinates: 339-1034 (+)
• Peptide sequence: MWIDSECMMWKFVEDSLKRESGTKVHHANIQASKAVADIIRTTLGPRSMLKMLLDASGGIVVTNDGNAILRELDIAHPAAKSMIELSRTQDEEVGDGTTSVIILAGEMLHVAEAFIEKNYHPTVICRAYNKALEDAIAVLDKIAMVIDPNDRATMLGLVKSCIGTKFTSQFGDLIADLAIDATTTVGVDIGQGLRDVDIKNYIKVEKVPGGQLEDSRVLKGVMFNKDVVAPG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_214499

• Blastp: T-complex protein 1 subunit gamma from Arabidopsis with 90.91% of identity
• Blastx: T-complex protein 1 subunit gamma from Arabidopsis with 90.91% of identity
• Eggnog: Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions (By similarity)(COG0459)
• Kegg: Link to kegg annotations (AT5G26360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443244.1)
• Pfam: TCP-1/cpn60 chaperonin family (PF00118.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;