Transcript | Ll_transcript_214072 |
---|---|
CDS coordinates | 1984-2418 (+) |
Peptide sequence | MPYIQQVAVGRLPELNVYGYDYPTKDGSAVRDYIHVMDLADGHIAALRKLFTTENLGCTAYNLGTGHGTSVLEMVTAFEKASGKKIPIKLCPRRPGDATEVYASTEKAEKELGWKAKYGTEEMCRDQWNWAKNNPWGYKGESLE* |
ORF Type | complete |
Blastp | UDP-glucose 4-epimerase from Pisum with 90.07% of identity |
---|---|
Blastx | UDP-glucose 4-epimerase from Pisum with 91.01% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446602.1) |
Pfam | GDP-mannose 4,6 dehydratase (PF16363.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer