| Transcript | Ll_transcript_214076 |
|---|---|
| CDS coordinates | 2442-2768 (+) |
| Peptide sequence | MDLADGHIAALRKLFTTENLGCTAYNLGTGHGTSVLEMVTAFEKASGKKIPIKLCPRRPGDATEVYASTEKAEKELGWKAKYGTEEMCRDQWNWAKNNPWGYKGESLE* |
| ORF Type | complete |
| Blastp | UDP-glucose 4-epimerase GEPI42 from Cyamopsis with 89.52% of identity |
|---|---|
| Blastx | UDP-glucose 4-epimerase GEPI42 from Cyamopsis with 89.29% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019446602.1) |
| Pfam | GDP-mannose 4,6 dehydratase (PF16363.4) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer