Protein coding transcript 2377

• Transcript: Ll_transcript_329230
• CDS coordinates: 2-499 (+)
• Peptide sequence: LDKHFIPSAQTGESKVFYHKMKGDYHRYLAEFAVGDKRKTSADKSLEAYKAATDVAASNLAPTHPIRLGLALNFSVFYYEILNSPDRACHLAKQAFDDAIAELDSLSEESYRDSTLIMQLLRDNLTLWTSSDGSEPEPAAEAPKAEDKPAEAAPEAAPEAEEPKA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_329230

• Blastp: 14-3-3 protein homolog from Trichoderma with 84.56% of identity
• Blastx: 14-3-3 protein homolog from Trichoderma with 85.71% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014522042.1)
• Pfam: 14-3-3 protein (PF00244.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;