Protein coding transcript 237727

• Transcript: Ll_transcript_214633
• CDS coordinates: 475-789 (+)
• Peptide sequence: MWTIFRTVFQFEALAFGSTAMCGRSSFWFWLISAITFYGATWEHFFTNSLILPVINGPTEGLMIIYVCHFFTAIVGSEWWAHQFGVSLPFLSWLPFSGGIPTYTA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_214633

• Blastp: Choline/ethanolaminephosphotransferase 1 from Arabidopsis with 73.68% of identity
• Blastx: Choline/ethanolaminephosphotransferase 1 from Arabidopsis with 61.67% of identity
• Eggnog: phosphotransferase 1(COG5050)
• Kegg: Link to kegg annotations (AT1G13560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417726.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;