Protein coding transcript 237755

• Transcript: Ll_transcript_213797
• CDS coordinates: 3-308 (+)
• Peptide sequence: ITHTSCLASHIKSFPPHTAPAGYVCPSCSTPIWPPKSVKDSGSRLHSKLKEAIMQLLRGEGMILRLIYHLEYSFEASCLIFIKWRMPSICATALIYEYSGK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_213797

• Blastp: Zinc finger protein-like 1 from Silurana with 47.92% of identity
• Blastx: Zinc finger protein-like 1 homolog from Nematostella with 47.37% of identity
• Eggnog: Zinc finger protein-like 1(ENOG410ZR2P)
• Kegg: Link to kegg annotations (779657)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451406.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;