Transcript | Ll_transcript_214586 |
---|---|
CDS coordinates | 232-1332 (+) |
Peptide sequence | MAKRGYKIQEFVAHSGTVNCLNLGKKECRRFITGGDDHKVNLWTIGKPTSLMSLSGHNSPVQSLAFDSAEVLVLGGASSGVIKLWDLEEAKLVRTVAGQRSSCTAIEFHPFGEFFASGYTDANLKIWDIRKKGCIHTYKGHSQGINTIKFTPDGRWVVSGGLDNVVKVWDLTAGKLLHDFKFHEGHITSIDFHPLEFLLATGSADRTVKFWDLETFEMIGSARREVSGVRSIAFHPDGRTLFTGLEDGLKVYSWEPVICHDTVDMGWTKLGDLCIHDGKLLGCSHFRNSVGVWVADISLIAPYADASDPKKKSEDTEQKLGLHGSKLNKVEDDVGPTSGLHSMSPDESKEIKNIYIDCKPLTLSIP* |
ORF Type | complete |
Blastp | Katanin p80 WD40 repeat-containing subunit B1 homolog from Arabidopsis with 67.33% of identity |
---|---|
Blastx | Katanin p80 WD40 repeat-containing subunit B1 homolog from Arabidopsis with 67.33% of identity |
Eggnog | Katanin p80 (WD repeat containing) subunit B 1(ENOG410XQAC) |
Kegg | Link to kegg annotations (AT5G23430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418885.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer