Protein coding transcript 237833

• Transcript: Ll_transcript_214580
• CDS coordinates: 461-910 (+)
• Peptide sequence: MIGSARREVSGVRSIAFHPDGRTLFTGLEDGLKVYSWEPVICHDTVDMGWTKLGDLCIHDGKLLGCSHFRNSVGVWVADISLIAPYADASDPKKKSEDTEQKLGLHGSKLNKVEDDVGPTSGLHSMSPDESKEIKNIYIDCKPLTLSIP*
• ORF Type: complete

Annotations of Ll_transcript_214580

• Blastp: Katanin p80 WD40 repeat-containing subunit B1 homolog from Arabidopsis with 52.94% of identity
• Blastx: Katanin p80 WD40 repeat-containing subunit B1 homolog from Arabidopsis with 56.36% of identity
• Eggnog: Katanin p80 (WD repeat containing) subunit B 1(ENOG410XQAC)
• Kegg: Link to kegg annotations (AT5G23430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418886.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;