Protein coding transcript 237945

• Transcript: Ll_transcript_214334
• CDS coordinates: 1-660 (+)
• Peptide sequence: LAEYLEKWEKDDKADLIIIKGAGRAFSAGGDLRVFYDGRKTKDSCAEVVYRYFWLCYHINTYKKTQVALVNGISMGGGSALMVQMNFSVVTEKTVFATPEASFGYHTDCGFSYIHSHLPGHFGEFLALTGARLNGKELVAVGLATHFVSSEKIAELEERLISLNSGDENAVRSVIKEFSSEIKLNEESILNKLSIIDESFSKDSVEEIIKSFVSFLTFR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_214334

• Blastp: 3-hydroxyisobutyryl-CoA hydrolase-like protein 5 from Arabidopsis with 74.53% of identity
• Blastx: 3-hydroxyisobutyryl-CoA hydrolase-like protein 5 from Arabidopsis with 74.53% of identity
• Eggnog: Enoyl-CoA hydratase(COG1024)
• Kegg: Link to kegg annotations (AT1G06550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464747.1)
• Pfam: Enoyl-CoA hydratase/isomerase (PF16113.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;