| Transcript | Ll_transcript_214346 |
|---|---|
| CDS coordinates | 367-738 (+) |
| Peptide sequence | MDLPLYNWLIRYDFRAGFWGVMGGPCLGIIPPFIEEFNYPLSNKCSGGNTSVFVNGRELHQKDLDLLALRGLPTESDRSYIIEISGRVLDEDTGEELDSLGKLAPTVEKVKHGFGMKASRAVP* |
| ORF Type | complete |
| Blastp | Extra-large guanine nucleotide-binding protein 1 from Arabidopsis with 33.75% of identity |
|---|---|
| Blastx | - |
| Eggnog | Guanine nucleotide binding protein (G protein) alpha(ENOG410XNVQ) |
| Kegg | Link to kegg annotations (AT2G23460) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019424022.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer