Transcript | Ll_transcript_213559 |
---|---|
CDS coordinates | 87-632 (+) |
Peptide sequence | MEPLRLKANYRCVPSLQQFYTGGPYAVSSDGSFIASACADSIKIVDSANSSIKFTLDGDSESVTALVLSPDDKLLFSSSHSRQIRVWDLSTLKCVRSWKGHDGPIMSMACHPSGGLLATGGADRKVLVWDVDGGFCTHFFKGHGGIVSCVMFHPNPEKQLVSIKLNALCIGLLSKPVIPSS* |
ORF Type | complete |
Blastp | Transducin beta-like protein 3 from Bos with 37.11% of identity |
---|---|
Blastx | Transducin beta-like protein 3 from Bos with 37.11% of identity |
Eggnog | transducin beta-like 3(ENOG410XPQD) |
Kegg | Link to kegg annotations (618429) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456972.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer