Protein coding transcript 237978

• Transcript: Ll_transcript_213563
• CDS coordinates: 87-956 (+)
• Peptide sequence: MEPLRLKANYRCVPSLQQFYTGGPYAVSSDGSFIASACADSIKIVDSANSSIKFTLDGDSESVTALVLSPDDKLLFSSSHSRQIRVWDLSTLKCVRSWKGHDGPIMSMACHPSGGLLATGGADRKVLVWDVDGGFCTHFFKGHGGIVSCVMFHPNPEKQLLFSGSDDGGDNATVRVWDLSKTKKKNCIATLDNHRSAVTSIAVSEDGWTLLSAGRDKVVTLWDLHDYSNKKTVITNEAVEAVCVIGAGSPFASSLDSYRQNAKKLVGSRPFYFLTVGERGVVRIWSSEG*
• ORF Type: complete

Annotations of Ll_transcript_213563

• Blastp: Transducin beta-like protein 3 from Rattus with 36.84% of identity
• Blastx: Transducin beta-like protein 3 from Rattus with 36.84% of identity
• Eggnog: transducin beta-like 3(ENOG410XPQD)
• Kegg: Link to kegg annotations (287120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456965.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;