Protein coding transcript 238

• Transcript: Ll_transcript_333288
• CDS coordinates: 1-381 (+)
• Peptide sequence: GNVPLWEAIVGGHESVSNVLVENGANMKYGDMGEFACIAAEQNNLNLLKDIMHYGGDITLPHSITGTTALHVAVSEDNVEIVKFLLEHGAAIDKPDMQGWTPRALADQQGHVDIKAIFESTGDPKPQ
• ORF Type: internal

Annotations of Ll_transcript_333288

• Blastp: Potassium channel AKT1 from Arabidopsis with 62.71% of identity
• Blastx: Potassium channel AKT1 from Arabidopsis with 62.71% of identity
• Eggnog: Potassium voltage-gated channel, subfamily H (Eag-related), member(ENOG410XPSE)
• Kegg: Link to kegg annotations (AT2G26650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463537.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;