Transcript | Ll_transcript_333288 |
---|---|
CDS coordinates | 1-381 (+) |
Peptide sequence | GNVPLWEAIVGGHESVSNVLVENGANMKYGDMGEFACIAAEQNNLNLLKDIMHYGGDITLPHSITGTTALHVAVSEDNVEIVKFLLEHGAAIDKPDMQGWTPRALADQQGHVDIKAIFESTGDPKPQ |
ORF Type | internal |
Blastp | Potassium channel AKT1 from Arabidopsis with 62.71% of identity |
---|---|
Blastx | Potassium channel AKT1 from Arabidopsis with 62.71% of identity |
Eggnog | Potassium voltage-gated channel, subfamily H (Eag-related), member(ENOG410XPSE) |
Kegg | Link to kegg annotations (AT2G26650) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463537.1) |
Pfam | Ankyrin repeats (3 copies) (PF12796.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer