Protein coding transcript 238107

• Transcript: Ll_transcript_214311
• CDS coordinates: 1225-1890 (+)
• Peptide sequence: MKTNGSGEVLVKSSFLADLQRRVLKAEAALRVKEDENDILHQRLQQYESRWSEYEMKMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDERDYSWEVGSNHKRQESNGTRSMSAGLSVISRLAEEFEQRSQVFGDDAKFLVEVKSGQVEANLNPDQELRRLKQMFEAWKKDYGTRLRETKVILNKLGSEDGALDKMKRKWWGRRNSTRMT*
• ORF Type: complete

Annotations of Ll_transcript_214311

• Blastp: Myosin-1 from Arabidopsis with 79.11% of identity
• Blastx: Myosin-1 from Arabidopsis with 73.64% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G19960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460646.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;