Protein coding transcript 238108

• Transcript: Ll_transcript_214312
• CDS coordinates: 193-1176 (+)
• Peptide sequence: MSETSTVSPVFQSIKSLPPKFKFTNNSSPGLGGKHGNGKLRSAAPVGSSSPGNSVLVGEDLNKVQGRAGGMDIFYEDSPYGGEGSSSEDRPLDADISLPLPSSSTSSRECKWSDTTPYASKKKLQSWFQLSNGNWELVKIITTSGTESVISLSDGKVSKVKDEALLPANPDILDGVDDLMQLSYLNEPSVLYNLQYRYNQNMIYTKAGPVLVAINPFKKVHLYGNDYIEAYKRKAIESPHVYAITDTAMREMMRDEVNQSIIIRSVLFAEFSFMRYCNHKLLCLYMMLQSKIFCGNLCKYIMNTGLTLYPLKTKGCPNVRCSHVWSG*
• ORF Type: complete

Annotations of Ll_transcript_214312

• Blastp: Myosin-1 from Arabidopsis with 58.49% of identity
• Blastx: Myosin-1 from Arabidopsis with 79.89% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G19960)
• CantataDB: Link to cantataDB annotations (CNT0001629)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428286.1)
• Pfam: Myosin head (motor domain) (PF00063.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;