Protein coding transcript 238118

• Transcript: Ll_transcript_214300
• CDS coordinates: 230-1129 (+)
• Peptide sequence: MSQPSRILPGLQSIKSLPPTFRTTSNQTPDFAEKQGDLKLKRTAVNGSSSAENGAVVEEISEADVQVHTGDSGLFNEDLAYSRKGVSLEGRPSIADEGVESVPLAFPSISMSSRERRWSDTTPYASKKKLQSWFQLPNGHWELGKIITSSGTESVISLPDGQVLKVEEESLVQANPDILDGVDDLMQLSYLNEPSVLYNLHYRYCQNMIYTKAGPVLVAINPFKTVPLYGNDYIEAYKRKAIESPHVYAIADTAIREMIRDEVNQSIIIRSVIIYEFSIYEQLVMANCWVFKLFLFCYL*
• ORF Type: complete

Annotations of Ll_transcript_214300

• Blastp: Myosin-1 from Arabidopsis with 59.41% of identity
• Blastx: Myosin-1 from Arabidopsis with 59.41% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G19960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460646.1)
• Pfam: Myosin head (motor domain) (PF00063.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;