Protein coding transcript 238156

• Transcript: Ll_transcript_215199
• CDS coordinates: 79-663 (+)
• Peptide sequence: MKNHQIHQLISLSFFLLIVCGTLATVNGADDLATKCGQVVEKVIPCLSFATGKAATPTKECCDAATEIKESNPQCLCYIIQQTHKGSPQSKQMGIQEDKLLQLPSVCNVKNASISLCPKLLGLSPSSPDAAIFTNASKLTPTSSAQSSTSTTTPQSKDGSYGNMIKPSMITDIIVLALAFLLIAIPTGFVSIYI*
• ORF Type: complete

Annotations of Ll_transcript_215199

• Blastp: Non-specific lipid transfer protein GPI-anchored 1 from Arabidopsis with 50.66% of identity
• Blastx: Non-specific lipid transfer protein GPI-anchored 1 from Arabidopsis with 60.4% of identity
• Eggnog: glycosylphosphatidylinositol-anchored lipid protein transfer 1(ENOG410YMSF)
• Kegg: Link to kegg annotations (AT1G27950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438297.1)
• Pfam: Probable lipid transfer (PF14368.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;