Transcript | Ll_transcript_215201 |
---|---|
CDS coordinates | 79-480 (+) |
Peptide sequence | MKNHQIHQLISLSFFLLIVCGTLATVNGADDLATKCGQVVEKVIPCLSFATGKAATPTKECCDAATEIKESNPQCLCYIIQQTHKGSPQSKQMGIQEDKLLQLPSVCNVKNASISLCPSKFLKYIYTFLIYSL* |
ORF Type | complete |
Blastp | Non-specific lipid transfer protein GPI-anchored 1 from Arabidopsis with 54.76% of identity |
---|---|
Blastx | Non-specific lipid transfer protein GPI-anchored 1 from Arabidopsis with 54.76% of identity |
Eggnog | glycosylphosphatidylinositol-anchored lipid protein transfer 1(ENOG410YMSF) |
Kegg | Link to kegg annotations (AT1G27950) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438297.1) |
Pfam | Probable lipid transfer (PF14368.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer