Protein coding transcript 238174

• Transcript: Ll_transcript_213495
• CDS coordinates: 2-619 (+)
• Peptide sequence: CRRSLDIERPTYTNLNRLVSQVISALTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGGGMEEGEF
• ORF Type: internal

Annotations of Ll_transcript_213495

• Blastp: Tubulin alpha-1 chain from Pisum with 99.03% of identity
• Blastx: Tubulin alpha-1 chain from Pisum with 99.03% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020209086.1)
• Pfam: Tubulin C-terminal domain (PF03953.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;