Protein coding transcript 238232

• Transcript: Ll_transcript_215537
• CDS coordinates: 1-603 (+)
• Peptide sequence: LCNMHCCIKSLVSSMEFIFLNLSYKMSNFPCSFVICTAMYVGVAIMGYLIFGDGTLSQYTLNMPQSLVATKIAMWTTVVNPFTKYALCMAPVALCMEELIPSNDRKFYVYSILIRTALVISTLLVGLAIPFFGLVMSLIGSLLTMFVTLIIPCACFLRIRRGRLSRFQVAFCITIMTVGIVASVIGSYSAISEIIESLRG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_215537

• Blastp: Amino acid transporter AVT1B from Arabidopsis with 68.05% of identity
• Blastx: Amino acid transporter AVT1B from Arabidopsis with 68.05% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT3G54830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435520.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;