Protein coding transcript 238301

• Transcript: Ll_transcript_215854
• CDS coordinates: 2-355 (-)
• Peptide sequence: GDRSSESQIQLRTELARPLQQLQDSARRIAEIQHECKLEINVNEYVESTVRPFLMDVIYSWSKGASFGDVIQMTDIFEGSIIRSARRLDEFLNQLRAAADAVGEVDLEKKFAAASESL
• ORF Type: internal

Annotations of Ll_transcript_215854

• Blastp: DExH-box ATP-dependent RNA helicase DExH10 from Arabidopsis with 83.76% of identity
• Blastx: DExH-box ATP-dependent RNA helicase DExH10 from Arabidopsis with 83.76% of identity
• Eggnog: helicase(COG4581)
• Kegg: Link to kegg annotations (AT2G06990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446453.1)
• Pfam: DSHCT (NUC185) domain (PF08148.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;