Protein coding transcript 238319

• Transcript: Ll_transcript_214236
• CDS coordinates: 855-1991 (+)
• Peptide sequence: MSGFENEVGLQHENEGMEISSMPLANPFMLASSDWGPLVSLSQVQAFGGSPMVSHSDFANSSYPLVLENQGMSCTSHLVQYISDSNHEVMVPMVPCYENGSFLEMVDVANSGYQPNYKPSNEAVIPGSAPNENRRKRGHDYNSTLNKNAAGDAMKGSFENNSNVVKEQDEKKYKLEQSSSAQLRGKQPAKKITDNSHSEEGPKENFVHLRAGRGKATNSHSLAERVRREKISERFRFLQELVPGCNKITGKAVMLDEIINYVQSLQQQVEFLSMKLVTVNPELNSDVIERILSKDSHIEHNRHIGGYGPTNNGSDPFSGASSHGTLPAMLSTSTQFLPLPRVKSENISIHNSCLLNVGNNYSFICSLFWTKSSKAYMK*
• ORF Type: complete

Annotations of Ll_transcript_214236

• Blastp: Transcription factor bHLH74 from Arabidopsis with 42.58% of identity
• Blastx: Transcription factor bHLH74 from Arabidopsis with 42.58% of identity
• Eggnog: Transcription factor(ENOG4111DWU)
• Kegg: Link to kegg annotations (AT1G10120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416626.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;