Protein coding transcript 238329

• Transcript: Ll_transcript_214221
• CDS coordinates: 855-1619 (+)
• Peptide sequence: MSGFENEVGLQHENEGMEISSMPLANPFMLASSDWGPLVSLSQVQAFGGSPMVSHSDFANSSYPLVLENQGMSCTSHLVQYISDSNHEVMVPMVPCYENGSFLEMVDVANSGYQPNYKPSNEAVIPGSAPNENRRKRGHDYNSTLNKNAAGDAMKGSFENNSNVVKEQDEKKYKLEQSSSAQLRGKQPAKKITDNSHSEEGPKENFVHLRAGRGKATNSHSLAERVTTILLQMLVIRKTFSFVNIEVMTPFDCR*
• ORF Type: complete

Annotations of Ll_transcript_214221

• Blastp: Transcription factor bHLH74 from Arabidopsis with 32.31% of identity
• Blastx: Transcription factor bHLH49 from Arabidopsis with 54.67% of identity
• Eggnog: Transcription factor(ENOG4111DWU)
• Kegg: Link to kegg annotations (AT1G10120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416626.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;