Protein coding transcript 238381

• Transcript: Ll_transcript_216369
• CDS coordinates: 220-813 (+)
• Peptide sequence: MGCCFRGSTTMPPIETSKPVTNEEYYSEPINLKQEVLIHIPRCKVHLMDEGEALELAQGGFMIIKTMDENVSLATIIKVGEDLQWPLTKDEPVVKLDVLHYLFTLPVKDGEPLSYGVSFSEESFGSLSLLDSFLKEHSCFSGLKLSRKSDLDWKEFAPRVEDYNHFLAKVIAEGTGQIVKGIFICSNAYTNKVWFSC*
• ORF Type: complete

Annotations of Ll_transcript_216369

• Blastp: Senescence/dehydration-associated protein At4g35985, chloroplastic from Arabidopsis with 31.8% of identity
• Blastx: Senescence/dehydration-associated protein At4g35985, chloroplastic from Arabidopsis with 31.8% of identity
• Eggnog: Spastic paraplegia 20 (Troyer syndrome)(ENOG410ZEPM)
• Kegg: Link to kegg annotations (AT4G35985)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446371.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;