Transcript | Ll_transcript_215656 |
---|---|
CDS coordinates | 698-1189 (+) |
Peptide sequence | MWDLNDSPDQRYDNKGKGVGSVSNSSSSAVVIEDDGSDEELKKRSSKIFGFSVTHDGGGDDDESMDSDNLPVTQQFFPVEEESEVTVPSGEGGSSSNFPRAHWVGVKFCQSEGLGGGKSVEMSQPMKKSRRGPRSRSSQYRGVTFYRRTGRWESHIWLVLYEP* |
ORF Type | complete |
Blastp | Floral homeotic protein APETALA 2 from Arabidopsis with 50.85% of identity |
---|---|
Blastx | Floral homeotic protein APETALA 2 from Arabidopsis with 54.98% of identity |
Eggnog | floral homeotic protein APETALA(ENOG410YBZ8) |
Kegg | Link to kegg annotations (AT4G36920) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421979.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer