Protein coding transcript 238477

• Transcript: Ll_transcript_58831
• CDS coordinates: 28-390 (+)
• Peptide sequence: MCFFAVRLAKLKANNVYKAPCDTSVLYPKTGGNMHEFRAITPCAVLDVIGPPYSKEDDRDCSYYKDHPYTDFPNREIGEVKDENDCYGWLEEIEMPQNSQMDRIEYMGPPIIDHNIYSIP*
• ORF Type: complete

Annotations of Ll_transcript_58831

• Blastp: Plant cysteine oxidase 2 from Arabidopsis with 48.6% of identity
• Blastx: Plant cysteine oxidase 2 from Arabidopsis with 48.6% of identity
• Eggnog: 2-aminoethanethiol(ENOG4111Y3H)
• Kegg: Link to kegg annotations (AT5G39890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451395.1)
• Pfam: PCO_ADO (PF07847.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;