Protein coding transcript 2385

• Transcript: Ll_transcript_428097
• CDS coordinates: 1-573 (+)
• Peptide sequence: LIFGNIDKFGGDIYYSVVTFMSEIILKDPTCFSALHKMGLPDAFLSSIESGILTSSKALTCIPNGLEAICLNAKGLGAVRASSSLQFLLGIFTSKKYVLAMNEAIVEISHYVAKLLHHVTSLRSAGVDIIIEIIERIASFGGSSGTGSPGKANEDTAMETDAEVKAKEGHCGPVGTPVDSSSEAIKDEQFI
• ORF Type: internal

Annotations of Ll_transcript_428097

• Blastp: E3 ubiquitin-protein ligase UPL2 from Arabidopsis with 37.04% of identity
• Blastx: E3 ubiquitin-protein ligase UPL1 from Arabidopsis with 41.86% of identity
• Eggnog: ubiquitin protein ligase(COG5021)
• Kegg: Link to kegg annotations (AT1G70320)
• CantataDB: Link to cantataDB annotations (CNT0001834)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434286.1)
• Pfam: Domain of Unknown Function (DUF913) (PF06025.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;